Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prcc Peptide - C-terminal region

Prcc Peptide - C-terminal region

Product Specifications

UniProt

B2RYA6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Prcc Rabbit Polyclonal Antibody (orb583723) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101170

Preservative

Lyophilized powder

AA Sequence

KKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKYG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Retinoblastoma (Ab-811) Antibody
8B0810-AAT 50 µg

Retinoblastoma (Ab-811) Antibody

Sign In for Pricing
View Details
Bicyclo[3.2.1]octane-2,4-dione
TRC-B529020-1G 1 g

Bicyclo[3.2.1]octane-2,4-dione

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/795), CF640R conjugate, 0.1mg/mL
BNC400795-500 1x 500 µL

CD56 / NCAM (NCAM1/795), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CMTM6 Antibody
KC-2603-01 50 μL

CMTM6 Antibody

Sign In for Pricing
View Details
CMTM6 Antibody
KC-2603-02 100 µL

CMTM6 Antibody

Sign In for Pricing
View Details
CMTM6 Antibody
KC-2603-03 1 mL

CMTM6 Antibody

Sign In for Pricing
View Details