Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bmp5 Peptide - C-terminal region

Bmp5 Peptide - C-terminal region

Product Specifications

UniProt

D4A7P9

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bmp5 Rabbit Polyclonal Antibody (orb331247) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101638

Preservative

Lyophilized powder

AA Sequence

NKSSSHQDPSRIPSAGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 4-chloro-1,6-naphthyridine-3-carboxylate
SDA97276-01 50 mg

Ethyl 4-chloro-1,6-naphthyridine-3-carboxylate

Sign In for Pricing
View Details
Ethyl 4-chloro-1,6-naphthyridine-3-carboxylate
SDA97276-02 0.5 g

Ethyl 4-chloro-1,6-naphthyridine-3-carboxylate

Sign In for Pricing
View Details
Bcam Mouse Gene Knockout Kit (CRISPR)
KN502076 1 Kit

Bcam Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
pT7-SNCA Plasmid
PVT54750 2 µg

pT7-SNCA Plasmid

Sign In for Pricing
View Details
C7orf46 shRNA (h) Lentiviral Particles
sc-89892-V 200 µL

C7orf46 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Pigeon Carbamylated LDL (CLDL) ELISA Kit
MBS9399942 Inquire

Pigeon Carbamylated LDL (CLDL) ELISA Kit

Sign In for Pricing
View Details