Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bmp5 Peptide - C-terminal region

Bmp5 Peptide - C-terminal region

Product Specifications

UniProt

D4A7P9

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bmp5 Rabbit Polyclonal Antibody (orb331247) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101638

Preservative

Lyophilized powder

AA Sequence

NKSSSHQDPSRIPSAGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant E.Coli Inorganic Pyrophosphatase
7-03403 5 µg

Recombinant E.Coli Inorganic Pyrophosphatase

Sign In for Pricing
View Details
LEMD2 (NM_181336) Human 3' UTR Clone
SC214560 10 µg

LEMD2 (NM_181336) Human 3' UTR Clone

Sign In for Pricing
View Details
PFKL Rabbit Monoclonal Antibody [Clone ID: R04-7A4]
TA384962 100 µL

PFKL Rabbit Monoclonal Antibody [Clone ID: R04-7A4]

Sign In for Pricing
View Details
Fragilis Conjugated Antibody
MBS9457286-01 0.1 mL (Biotin)

Fragilis Conjugated Antibody

Sign In for Pricing
View Details
Fragilis Conjugated Antibody
MBS9457286-02 0.1 mL (AF350)

Fragilis Conjugated Antibody

Sign In for Pricing
View Details
Fragilis Conjugated Antibody
MBS9457286-03 0.1 mL (AF405)

Fragilis Conjugated Antibody

Sign In for Pricing
View Details