Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stim2 Peptide - C-terminal region

Stim2 Peptide - C-terminal region

Product Specifications

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Stim2 Rabbit Polyclonal Antibody (orb585828) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074572

Preservative

Lyophilized powder

AA Sequence

IFSPASRVYNGILEKSCSMHQLSSGIPVPHPRHTSCSSAGNDSKPVQEAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-AQP2 Antibody (Monoclonal, 32A23)
M00935 100 µL

Anti-AQP2 Antibody (Monoclonal, 32A23)

Sign In for Pricing
View Details
CBFB Adenovirus (Mouse)
15104054 1.0 mL

CBFB Adenovirus (Mouse)

Sign In for Pricing
View Details
Olig2 Antibody (FITC)
orb517722-01 50 µg

Olig2 Antibody (FITC)

Sign In for Pricing
View Details
Olig2 Antibody (FITC)
orb517722-02 100 µg

Olig2 Antibody (FITC)

Sign In for Pricing
View Details
CD7 siRNA (Human)
MBS8211266-01 15 nmol

CD7 siRNA (Human)

Sign In for Pricing
View Details
CD7 siRNA (Human)
MBS8211266-02 30 nmol

CD7 siRNA (Human)

Sign In for Pricing
View Details