Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stim2 Peptide - C-terminal region

Stim2 Peptide - C-terminal region

Product Specifications

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Stim2 Rabbit Polyclonal Antibody (orb585828) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001074572

Preservative

Lyophilized powder

AA Sequence

IFSPASRVYNGILEKSCSMHQLSSGIPVPHPRHTSCSSAGNDSKPVQEAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase, NAGPA ELISA Kit
MBS9337653-01 48 Well

Mouse N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase, NAGPA ELISA Kit

Sign In for Pricing
View Details
Mouse N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase, NAGPA ELISA Kit
MBS9337653-02 96 Well

Mouse N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase, NAGPA ELISA Kit

Sign In for Pricing
View Details
Mouse N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase, NAGPA ELISA Kit
MBS9337653-03 5x 96 Well

Mouse N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase, NAGPA ELISA Kit

Sign In for Pricing
View Details
Mouse N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase, NAGPA ELISA Kit
MBS9337653-04 10x 96 Well

Mouse N-acetylglucosamine-1-phosphodiester alpha-N-acetylglucosaminidase, NAGPA ELISA Kit

Sign In for Pricing
View Details
Mouse Ccer1 qPCR Primer Pair
QM32578S 200 Tests

Mouse Ccer1 qPCR Primer Pair

Sign In for Pricing
View Details
Human APOBEC3G knockout cell line
ABC-KH0812 1 Vial

Human APOBEC3G knockout cell line

Sign In for Pricing
View Details