Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nle1 Peptide - C-terminal region

Nle1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AL022765, BC018399, Nle

UniProt

Q8VEJ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nle1 Rabbit Polyclonal Antibody (orb586235) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663406

Preservative

Lyophilized powder

AA Sequence

FTLFLWSPAEDKKPLARMTGHQALINQVLFSPDSRIVASASFDKSIKLWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,2',5'-Trichloroacetophenone
TRC-T891530-25MG 25 mg

2,2',5'-Trichloroacetophenone

Sign In for Pricing
View Details
Mouse Tcf4 activation kit by CRISPRa
GA204239 1 Kit

Mouse Tcf4 activation kit by CRISPRa

Sign In for Pricing
View Details
ATP5MC1 Human Gene Knockout Kit (CRISPR)
KN400292 1 Kit

ATP5MC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IceRacks
R8013 6 Units/Case

IceRacks

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (R1/69), CF405S conjugate, 0.1mg/mL
BNC042096-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (R1/69), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS502287 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details