Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nle1 Peptide - C-terminal region

Nle1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AL022765, BC018399, Nle

UniProt

Q8VEJ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nle1 Rabbit Polyclonal Antibody (orb586235) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663406

Preservative

Lyophilized powder

AA Sequence

FTLFLWSPAEDKKPLARMTGHQALINQVLFSPDSRIVASASFDKSIKLWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bromodeoxyuridine (BrdU) (Proliferation Marker) (BRD2888R), 0.2mg/mL
BNUB2888-100 1x 100 µL

Bromodeoxyuridine (BrdU) (Proliferation Marker) (BRD2888R), 0.2mg/mL

Sign In for Pricing
View Details
RGS3 (NM_021106) Human Recombinant Protein
TP324111 20 µg

RGS3 (NM_021106) Human Recombinant Protein

Sign In for Pricing
View Details
HTRA1 (NM_002775) Human Over-expression Lysate
LC400983 20 µg

HTRA1 (NM_002775) Human Over-expression Lysate

Sign In for Pricing
View Details
MGP (NM_000900) Human Over-expression Lysate
LY400323 100 µg

MGP (NM_000900) Human Over-expression Lysate

Sign In for Pricing
View Details
a-Tocopherol
TRC-T526125-5G 5 g

a-Tocopherol

Sign In for Pricing
View Details
ECM2 Human Gene Knockout Kit (CRISPR)
KN417806 1 Kit

ECM2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details