Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nle1 Peptide - C-terminal region

Nle1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AL022765, BC018399, Nle

UniProt

Q8VEJ4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nle1 Rabbit Polyclonal Antibody (orb586235) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_663406

Preservative

Lyophilized powder

AA Sequence

FTLFLWSPAEDKKPLARMTGHQALINQVLFSPDSRIVASASFDKSIKLWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon: right
CS711816 5x 5 µm

Tissue FFPE Sections, Colon: right

Sign In for Pricing
View Details
Myc tag, AlpHcAbs® Mouse IgG2b
HA710207 100 µg

Myc tag, AlpHcAbs® Mouse IgG2b

Sign In for Pricing
View Details
MARCKS Antibody
KC-2198-01 50 μL

MARCKS Antibody

Sign In for Pricing
View Details
MARCKS Antibody
KC-2198-02 100 µL

MARCKS Antibody

Sign In for Pricing
View Details
MARCKS Antibody
KC-2198-03 1 mL

MARCKS Antibody

Sign In for Pricing
View Details
Pipette Stand BPIC-305
BPIC-305 1 Unit

Pipette Stand BPIC-305

Sign In for Pricing
View Details