Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arpc5 Peptide - N-terminal region

Arpc5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

5830443F10Rik, p16-Arc

UniProt

Q9CPW4

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Arpc5 Rabbit Polyclonal Antibody (orb326539) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080645

Preservative

Lyophilized powder

AA Sequence

VDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPIN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD272 (BTLA) Human Gene Knockout Kit (CRISPR)
KN419458 1 Kit

CD272 (BTLA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRIM68 Human Gene Knockout Kit (CRISPR)
KN417536 1 Kit

TRIM68 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human PABP (PABPC1) activation kit by CRISPRa
GA108954 1 Kit

Human PABP (PABPC1) activation kit by CRISPRa

Sign In for Pricing
View Details
PSMC6 Human Gene Knockout Kit (CRISPR)
KN402809 1 Kit

PSMC6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human FSIP1 activation kit by CRISPRa
GA116036 1 Kit

Human FSIP1 activation kit by CRISPRa

Sign In for Pricing
View Details
APOLD1 Human Gene Knockout Kit (CRISPR)
KN423903 1 Kit

APOLD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details