Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arpc5 Peptide - N-terminal region

Arpc5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

5830443F10Rik, p16-Arc

UniProt

Q9CPW4

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Arpc5 Rabbit Polyclonal Antibody (orb326539) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080645

Preservative

Lyophilized powder

AA Sequence

VDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPIN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ROS1 Recombinant Rabbit Monoclonal Antibody [PD01-27]
HA721420 100 µL

ROS1 Recombinant Rabbit Monoclonal Antibody [PD01-27]

Sign In for Pricing
View Details
MerTK (Innate Immune Checkpoint) (MERTK/3022), CF568 conjugate, 0.1mg/mL
BNC683022-500 1x 500 µL

MerTK (Innate Immune Checkpoint) (MERTK/3022), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human MOGAT3 activation kit by CRISPRa
GA117630 1 Kit

Human MOGAT3 activation kit by CRISPRa

Sign In for Pricing
View Details
S100P Antibody
KC-1702-01 50 μL

S100P Antibody

Sign In for Pricing
View Details
S100P Antibody
KC-1702-02 100 µL

S100P Antibody

Sign In for Pricing
View Details
S100P Antibody
KC-1702-03 1 mL

S100P Antibody

Sign In for Pricing
View Details