Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Erc2 Peptide - C-terminal region

Erc2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

6430531D06, CAST, CAST1/ERC2, D14Ertd171e, ELKS2alpha

UniProt

Q6PH08

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Erc2 Rabbit Polyclonal Antibody (orb326540) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_808482

Preservative

Lyophilized powder

AA Sequence

TQNRMKLMADNYDEDHHHYHHHHHHHHHRSPGRSQHSNHRPSPDQLSEGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFDP1
CSB-CL005272HU 10 μg Plasmid + 200 μL Glycerol

CFDP1

Sign In for Pricing
View Details
Anti-SLC7A3 Antibody Picoband®, Dylight594 Conjugate
A09720-3-Dylight594 100 µg

Anti-SLC7A3 Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
[2- (3-Chlorophenyl) -1-methylpiperidin-3-yl]methanamine
JDC14805-01 50 mg

[2- (3-Chlorophenyl) -1-methylpiperidin-3-yl]methanamine

Sign In for Pricing
View Details
[2- (3-Chlorophenyl) -1-methylpiperidin-3-yl]methanamine
JDC14805-02 0.5 g

[2- (3-Chlorophenyl) -1-methylpiperidin-3-yl]methanamine

Sign In for Pricing
View Details
96 Well V Bottom ELISA Plates, 300μL, Undetachable
EP60012M 300μL x 96, V bottom

96 Well V Bottom ELISA Plates, 300μL, Undetachable

Sign In for Pricing
View Details
Human MYRFL qPCR Primer Pair
QH67497S 200 Tests

Human MYRFL qPCR Primer Pair

Sign In for Pricing
View Details