Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Erc2 Peptide - C-terminal region

Erc2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

6430531D06, CAST, CAST1/ERC2, D14Ertd171e, ELKS2alpha

UniProt

Q6PH08

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Erc2 Rabbit Polyclonal Antibody (orb326540) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_808482

Preservative

Lyophilized powder

AA Sequence

TQNRMKLMADNYDEDHHHYHHHHHHHHHRSPGRSQHSNHRPSPDQLSEGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC100361258 3'UTR Luciferase Stable Cell Line
TU207893 1.0 mL

LOC100361258 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
TRPM4 inhibitor 8
orb1685221-01 1 ml x 10 mM (in DMSO)

TRPM4 inhibitor 8

Sign In for Pricing
View Details
TRPM4 inhibitor 8
orb1685221-02 10 mg

TRPM4 inhibitor 8

Sign In for Pricing
View Details
TRPM4 inhibitor 8
orb1685221-03 25 mg

TRPM4 inhibitor 8

Sign In for Pricing
View Details
TRPM4 inhibitor 8
orb1685221-04 50 mg

TRPM4 inhibitor 8

Sign In for Pricing
View Details
TRPM4 inhibitor 8
orb1685221-05 100 mg

TRPM4 inhibitor 8

Sign In for Pricing
View Details