Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enpep Peptide - C-terminal region

Enpep Peptide - C-terminal region

Product Specifications

Product Name Alternative

6030431M22Rik, APA, Bp-1/6C3, Ly-51, Ly51

UniProt

P16406

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Enpep Rabbit Polyclonal Antibody (orb586284) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031960

Preservative

Lyophilized powder

AA Sequence

NTELQLWQMQSFFAKYPNAGAGAKPREQVLETVKNNIEWLNVNRQSIREW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BXDC5 antibody
70R-4968 50 ug

BXDC5 antibody

Sign In for Pricing
View Details
Recombinant Human VPS33B Protein, N-His
E55P4528 50 µg

Recombinant Human VPS33B Protein, N-His

Sign In for Pricing
View Details
MZB1, 1-97aa, Human, His tag, E.coli
E53A03073 50 µg

MZB1, 1-97aa, Human, His tag, E.coli

Sign In for Pricing
View Details
PAFAH1B3 Mouse Monoclonal Antibody [Clone ID: LBI5D2]
AMM16508VCF 100 µg

PAFAH1B3 Mouse Monoclonal Antibody [Clone ID: LBI5D2]

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Pantothenate Kinase 1 (PANK1)
MBS2067718-01 0.1 mL

PE-Linked Polyclonal Antibody to Pantothenate Kinase 1 (PANK1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Pantothenate Kinase 1 (PANK1)
MBS2067718-02 0.2 mL

PE-Linked Polyclonal Antibody to Pantothenate Kinase 1 (PANK1)

Sign In for Pricing
View Details