Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Enpep Peptide - C-terminal region

Enpep Peptide - C-terminal region

Product Specifications

Product Name Alternative

6030431M22Rik, APA, Bp-1/6C3, Ly-51, Ly51

UniProt

P16406

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Enpep Rabbit Polyclonal Antibody (orb586284) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031960

Preservative

Lyophilized powder

AA Sequence

NTELQLWQMQSFFAKYPNAGAGAKPREQVLETVKNNIEWLNVNRQSIREW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Human CRY1 pAb
PA7280-01 50 μL

Rabbit Anti-Human CRY1 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human CRY1 pAb
PA7280-02 100 μL

Rabbit Anti-Human CRY1 pAb

Sign In for Pricing
View Details
RAB36 sgRNA CRISPR Lentivector (Human) (Target 3)
K1773904 1.0 µg DNA

RAB36 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Mouse Monoclonal Ku70/XRCC6 Antibody (KU729) [PerCP]
NBP2-34663PCP 0.1 mL

Mouse Monoclonal Ku70/XRCC6 Antibody (KU729) [PerCP]

Sign In for Pricing
View Details
PAX1 Antibody
A33696-50UG 50 µg

PAX1 Antibody

Sign In for Pricing
View Details
Cnot3 AAV siRNA Pooled Vector
16489166 1.0 µg

Cnot3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details