Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUS4L Peptide - N-terminal region

DUS4L Peptide - N-terminal region

Product Specifications

Product Name Alternative

DUS4, PP35

UniProt

O95620

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DUS4L Rabbit Polyclonal Antibody (orb586988) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_853559

Preservative

Lyophilized powder

AA Sequence

SKLAFRTLVRKYSCDLCYTPMIVAADFVKSIKARDSEFTTNQGDCPLIVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RB (B-Cell Marker) (PTPRC/2877R), CF594 conjugate, 0.1mg/mL
BNC942877-500 1x 500 µL

CD45RB (B-Cell Marker) (PTPRC/2877R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NFIL3 Human Gene Knockout Kit (CRISPR)
KN401537 1 Kit

NFIL3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
S100A12 (NM_005621) Human Recombinant Protein
TP310002M 100 µg

S100A12 (NM_005621) Human Recombinant Protein

Sign In for Pricing
View Details
MTSPT (3-TRIMETHYLAMMONIUMPROPYL METHAN
#91027 1x 100 mg

MTSPT (3-TRIMETHYLAMMONIUMPROPYL METHAN

Sign In for Pricing
View Details
Lynx1 (NM_011838) Mouse Tagged ORF Clone
MG200505 10 µg

Lynx1 (NM_011838) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PMA Real-Time PCR Bacterial Viability Kit - E. coli (uidA)
#31050 1 Kit

PMA Real-Time PCR Bacterial Viability Kit - E. coli (uidA)

Sign In for Pricing
View Details