Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAPPC6A Peptide - N-terminal region

TRAPPC6A Peptide - N-terminal region

Product Specifications

Product Name Alternative

TRS33

UniProt

O75865

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRAPPC6A Rabbit Polyclonal Antibody (orb587122) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077013

Preservative

Lyophilized powder

AA Sequence

HDPDPGPGVSAGLRGEEAGATKGQKMSLSVLEGMGFRVGQALGERLPRET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RAB13 Antibody
M04339-01 50 µL

Anti-RAB13 Antibody

Sign In for Pricing
View Details
Anti-RAB13 Antibody
M04339-02 200 µL

Anti-RAB13 Antibody

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Interleukin 1 Alpha (IL1a)
MBS2150924-01 0.1 mL

APC_Cy7-Linked Monoclonal Antibody to Interleukin 1 Alpha (IL1a)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Interleukin 1 Alpha (IL1a)
MBS2150924-02 0.2 mL

APC_Cy7-Linked Monoclonal Antibody to Interleukin 1 Alpha (IL1a)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Interleukin 1 Alpha (IL1a)
MBS2150924-03 0.5 mL

APC_Cy7-Linked Monoclonal Antibody to Interleukin 1 Alpha (IL1a)

Sign In for Pricing
View Details
APC_Cy7-Linked Monoclonal Antibody to Interleukin 1 Alpha (IL1a)
MBS2150924-04 1 mL

APC_Cy7-Linked Monoclonal Antibody to Interleukin 1 Alpha (IL1a)

Sign In for Pricing
View Details