Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9orf16 Peptide - middle region

C9orf16 Peptide - middle region

Product Specifications

UniProt

Q9BUW7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C9orf16 Rabbit Polyclonal Antibody (orb587123) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077017

Preservative

Lyophilized powder

AA Sequence

INSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLGEAPSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Casein Kinase 1 alpha (CSNK1A1) (C-term) Rabbit Polyclonal Antibody
AP14042PU-N 400 µL

Casein Kinase 1 alpha (CSNK1A1) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Bile duct
CS507972 5x 5 µm

Frozen Tissue Sections, Bile duct

Sign In for Pricing
View Details
Vilaprisan-D4
TRC-V995621-25MG 25 mg

Vilaprisan-D4

Sign In for Pricing
View Details
MCT7 (SLC16A6) (NM_001174166) Human Over-expression Lysate
LC433227 20 µg

MCT7 (SLC16A6) (NM_001174166) Human Over-expression Lysate

Sign In for Pricing
View Details
EEF1A1 (C-term) Rabbit Polyclonal Antibody
AP17304PU-N 400 µL

EEF1A1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Triticum vulgare Lectin (Wheat Germ) -WGA-, 1mL 20nm
GP-2101-20 1 mL

Colloidal Gold Conjugated Triticum vulgare Lectin (Wheat Germ) -WGA-, 1mL 20nm

Sign In for Pricing
View Details