Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9orf16 Peptide - middle region

C9orf16 Peptide - middle region

Product Specifications

UniProt

Q9BUW7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C9orf16 Rabbit Polyclonal Antibody (orb587123) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077017

Preservative

Lyophilized powder

AA Sequence

INSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLGEAPSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Ovary: left
CS700115 5x 5 µm

Tissue FFPE Sections, Ovary: left

Sign In for Pricing
View Details
Human CUX1 activation kit by CRISPRa
GA101078 1 Kit

Human CUX1 activation kit by CRISPRa

Sign In for Pricing
View Details
FIZ1 (NM_032836) Human Over-expression Lysate
LC403209 20 µg

FIZ1 (NM_032836) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant CD32 Antibody
RC-4753-01 50 μL

Recombinant CD32 Antibody

Sign In for Pricing
View Details
Recombinant CD32 Antibody
RC-4753-02 100 µL

Recombinant CD32 Antibody

Sign In for Pricing
View Details
Recombinant CD32 Antibody
RC-4753-03 1 mL

Recombinant CD32 Antibody

Sign In for Pricing
View Details