Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNJL Peptide - C-terminal region

CCNJL Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCNJL Rabbit Polyclonal Antibody (orb587127) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078841

Preservative

Lyophilized powder

AA Sequence

GQPATTLAQFQTPVQDLCLAYRDSLQAHRSGSLLSGSTGSSLHTPYQPLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FGFBP2 Polyclonal Antibody
TMAB-05996-01 50 μL

Anti-FGFBP2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-FGFBP2 Polyclonal Antibody
TMAB-05996-02 100 µL

Anti-FGFBP2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-FGFBP2 Polyclonal Antibody
TMAB-05996-03 200 µL

Anti-FGFBP2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-KAP1/TIF1beta Mouse mAb
MBS475028-01 0.1 mL

Anti-KAP1/TIF1beta Mouse mAb

Sign In for Pricing
View Details
Anti-KAP1/TIF1beta Mouse mAb
MBS475028-02 5x 0.1 mL

Anti-KAP1/TIF1beta Mouse mAb

Sign In for Pricing
View Details
PERK (R87) polyclonal antibody
orb643366-01 25 µL

PERK (R87) polyclonal antibody

Sign In for Pricing
View Details