Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCNJL Peptide - C-terminal region

CCNJL Peptide - C-terminal region

Product Specifications

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCNJL Rabbit Polyclonal Antibody (orb587127) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078841

Preservative

Lyophilized powder

AA Sequence

GQPATTLAQFQTPVQDLCLAYRDSLQAHRSGSLLSGSTGSSLHTPYQPLQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR6998 Mouse qPCR Primer Pair (MI0022846)
MP300983 200 Reactions

MIR6998 Mouse qPCR Primer Pair (MI0022846)

Sign In for Pricing
View Details
Glutamate dehydrogenase 1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62249R-BF488-01 20 µL

Glutamate dehydrogenase 1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Glutamate dehydrogenase 1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62249R-BF488-02 100 µL

Glutamate dehydrogenase 1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
CD45 Antibody - Biotin Conjugated
OAPA00144-500UG 0.5 mg

CD45 Antibody - Biotin Conjugated

Sign In for Pricing
View Details
Compound NP-015046
MBS5794667 Inquire

Compound NP-015046

Sign In for Pricing
View Details
Dop1R1 Antibody
A78034-50UL 50 μL

Dop1R1 Antibody

Sign In for Pricing
View Details