Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC25 Peptide - C-terminal region

TTC25 Peptide - C-terminal region

Product Specifications

UniProt

Q96NG3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTC25 Rabbit Polyclonal Antibody (orb326820) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113609

Preservative

Lyophilized powder

AA Sequence

RLSGEFSRQEPEELKKLSEVGRREPEELGKTQFGEIGETKKTGNEMEKEY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hdgfl3 Mouse qPCR Template Standard (NM_013886)
MK204340 1 Kit

Hdgfl3 Mouse qPCR Template Standard (NM_013886)

Sign In for Pricing
View Details
NARG2 Antibody FITC Conjugated
orb1542072 100 µL

NARG2 Antibody FITC Conjugated

Sign In for Pricing
View Details
PRKACA (Protein Kinase, cAMP-Dependent, Catalytic, alpha, MGC102831, MGC48865, PKACA)
250464 200 µL

PRKACA (Protein Kinase, cAMP-Dependent, Catalytic, alpha, MGC102831, MGC48865, PKACA)

Sign In for Pricing
View Details
Goose parvovirus
PCR-V027-01 PCR-V027-48D

Goose parvovirus

Sign In for Pricing
View Details
Goose parvovirus
PCR-V027-02 PCR-V027-96D

Goose parvovirus

Sign In for Pricing
View Details
SF3A3 (NM_006802) Human Recombinant Protein
TP303895 20 µg

SF3A3 (NM_006802) Human Recombinant Protein

Sign In for Pricing
View Details