Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEDAG Peptide - middle region

MEDAG Peptide - middle region

Product Specifications

Product Name Alternative

AWMS3, hAWMS3

UniProt

Q5VYS4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MEDAG Rabbit Polyclonal Antibody (orb326838) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116238

Preservative

Lyophilized powder

AA Sequence

MLFFINVQTKKDTSKERTYAFLVNTRHPKIRRQIEQGMDMVISSVIGESY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TissueScan, Prostate Cancer cDNA Array III
HPRT303 5 Panels

TissueScan, Prostate Cancer cDNA Array III

Sign In for Pricing
View Details
Anti-Phospho Tyrosine Antibody
OC-178-01 50 μL

Anti-Phospho Tyrosine Antibody

Sign In for Pricing
View Details
Anti-Phospho Tyrosine Antibody
OC-178-02 100 µL

Anti-Phospho Tyrosine Antibody

Sign In for Pricing
View Details
Anti-Phospho Tyrosine Antibody
OC-178-03 1 mL

Anti-Phospho Tyrosine Antibody

Sign In for Pricing
View Details
CAMK2B Mouse Monoclonal Antibody [Clone ID: OTI10G2]
CF808346 100 µg

CAMK2B Mouse Monoclonal Antibody [Clone ID: OTI10G2]

Sign In for Pricing
View Details
Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3291), CF640R conjugate, 0.1mg/mL
BNC403291-100 1x 100 µL

Sarcomeric Actinin Alpha 2 / ACTN2 (ACTN2/3291), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details