Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEDAG Peptide - middle region

MEDAG Peptide - middle region

Product Specifications

Product Name Alternative

AWMS3, hAWMS3

UniProt

Q5VYS4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MEDAG Rabbit Polyclonal Antibody (orb326838) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116238

Preservative

Lyophilized powder

AA Sequence

MLFFINVQTKKDTSKERTYAFLVNTRHPKIRRQIEQGMDMVISSVIGESY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCMA Recombinant Rabbit multiclonal Antibody
HA723967 100 µL

BCMA Recombinant Rabbit multiclonal Antibody

Sign In for Pricing
View Details
Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3102), CF594 conjugate, 0.1mg/mL
BNC943102-100 1x 100 µL

Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3102), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GM CSF (CSF2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A3]
TA808006AM 100 µL

GM CSF (CSF2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1A3]

Sign In for Pricing
View Details
SARS-CoV-2 (COVID-19) S protein RBD (L452R), His Tag
SPD-C52He-100ug 100 µg

SARS-CoV-2 (COVID-19) S protein RBD (L452R), His Tag

Sign In for Pricing
View Details
CD73 (Immuno-Oncology Target) (NT5E/2503), 0.2mg/mL
BNUB2503-100 1x 100 µL

CD73 (Immuno-Oncology Target) (NT5E/2503), 0.2mg/mL

Sign In for Pricing
View Details
NCR3 Rabbit Polyclonal Antibody
AP21200PU-N 100 µg

NCR3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details