CCDC120 Peptide - C-terminal region
CCDC120 Peptide - C-terminal region
Product Specifications
UniProt
Q96HB5
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCDC120 Rabbit Polyclonal Antibody (orb587171) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_296375
Preservative
Lyophilized powder
AA Sequence
SGSQDSQMGFPRADPASDRASLFVARTRRSNSSEALLVDRAAGGGAGSPP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6275457-01 0.2 mL
ARX, NT (ARX, Homeobox protein ARX, Aristaless-related homeobox) (AP)
Sign In for Pricing
View Details MBS6275457-02 5x 0.2 mL
ARX, NT (ARX, Homeobox protein ARX, Aristaless-related homeobox) (AP)
Sign In for Pricing
View Details 
VAng-Lsx2836-50gEcoli 50 µg (E. coli)
Recombinant Corynebacterium Diphtheriae rplO Protein (aa 1-148)
Sign In for Pricing
View Details 
MBS6274157-01 0.1 mL
AP4M1, ID (AP4M1, MUARP2, AP-4 complex subunit mu-1, AP-4 adapter complex mu subunit, Adapter-related protein complex 4 mu-1 subunit, Mu subunit of AP-4, Mu-adaptin-related protein 2, Mu4-adaptin) (MaxLight 750)
Sign In for Pricing
View Details MBS6274157-02 5x 0.1 mL
AP4M1, ID (AP4M1, MUARP2, AP-4 complex subunit mu-1, AP-4 adapter complex mu subunit, Adapter-related protein complex 4 mu-1 subunit, Mu subunit of AP-4, Mu-adaptin-related protein 2, Mu4-adaptin) (MaxLight 750)
Sign In for Pricing
View Details