Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC120 Peptide - C-terminal region

CCDC120 Peptide - C-terminal region

Product Specifications

UniProt

Q96HB5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC120 Rabbit Polyclonal Antibody (orb587171) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_296375

Preservative

Lyophilized powder

AA Sequence

SGSQDSQMGFPRADPASDRASLFVARTRRSNSSEALLVDRAAGGGAGSPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HCN4 Antibody
CTA1274-01 30 µL

Anti-HCN4 Antibody

Sign In for Pricing
View Details
Anti-HCN4 Antibody
CTA1274-02 50 μL

Anti-HCN4 Antibody

Sign In for Pricing
View Details
Anti-HCN4 Antibody
CTA1274-03 100 µL

Anti-HCN4 Antibody

Sign In for Pricing
View Details
Anti-HCN4 Antibody
CTA1274-04 200 µL

Anti-HCN4 Antibody

Sign In for Pricing
View Details
OAAF06485-100UG - HINT1 Antibody
OAAF06485-100UG 100 µg

OAAF06485-100UG - HINT1 Antibody

Sign In for Pricing
View Details
LOC100041296 siRNA (m)
sc-147614 10 µM

LOC100041296 siRNA (m)

Sign In for Pricing
View Details