Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC97 Peptide - C-terminal region

CCDC97 Peptide - C-terminal region

Product Specifications

UniProt

Q96F63

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC97 Rabbit Polyclonal Antibody (orb587172) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443080

Preservative

Lyophilized powder

AA Sequence

LDGKDGDFDYSTVDDNPDFDNLDIVARDEEERYFDEEEPEDAPSPELDGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAFK Mouse Monoclonal Antibody [Clone ID: AT2F7]
AM50032PU-S 50 µL

MAFK Mouse Monoclonal Antibody [Clone ID: AT2F7]

Sign In for Pricing
View Details
Frozen Tissue Blocks, Pleura
CB501795 1 Block

Frozen Tissue Blocks, Pleura

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB511887 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Mouse Serum Amyloid A2 (SAA2) ELISA Kit
RDR-SAA2-Mu-01 96 Tests

Mouse Serum Amyloid A2 (SAA2) ELISA Kit

Sign In for Pricing
View Details
Mouse Serum Amyloid A2 (SAA2) ELISA Kit
RDR-SAA2-Mu-02 48 Tests

Mouse Serum Amyloid A2 (SAA2) ELISA Kit

Sign In for Pricing
View Details
BCL2A1 (BH3 Domain) Rabbit Polyclonal Antibody
AP11292PU-N 400 µL

BCL2A1 (BH3 Domain) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details