Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC97 Peptide - C-terminal region

CCDC97 Peptide - C-terminal region

Product Specifications

UniProt

Q96F63

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC97 Rabbit Polyclonal Antibody (orb587172) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443080

Preservative

Lyophilized powder

AA Sequence

LDGKDGDFDYSTVDDNPDFDNLDIVARDEEERYFDEEEPEDAPSPELDGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS501507 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Pmf1 (NM_025928) Mouse Tagged ORF Clone
MG202074 10 µg

Pmf1 (NM_025928) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Stool DNA Isolation Kit
27600 50 Preparations

Stool DNA Isolation Kit

Sign In for Pricing
View Details
RRAD (NM_001128850) Human Over-expression Lysate
LC427008 20 µg

RRAD (NM_001128850) Human Over-expression Lysate

Sign In for Pricing
View Details
Dot1L/KMT4 Polyclonal Antibody
E-AB-90263-01 60 µL

Dot1L/KMT4 Polyclonal Antibody

Sign In for Pricing
View Details
Dot1L/KMT4 Polyclonal Antibody
E-AB-90263-02 120 µL

Dot1L/KMT4 Polyclonal Antibody

Sign In for Pricing
View Details