Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMM29 Peptide - C-terminal region

TIMM29 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TIM29, C19orf52

UniProt

Q9BSF4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TIMM29 Rabbit Polyclonal Antibody (orb326845) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_612367

Preservative

Lyophilized powder

AA Sequence

PQQLHSETNERLFDEKYKPVVLTDDQVDQALWEEQVLQKEKKDRLALSQA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LL-37 FK-13
HY-P4836 1 Each

LL-37 FK-13

Sign In for Pricing
View Details
RNF14 Recombinant Protein (Mouse)
RP168488 100 µg

RNF14 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Rbm46 (NM_001135717) Rat Tagged Lenti ORF Clone
RR212631L4 10 µg

Rbm46 (NM_001135717) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
UBCH9 (Ubiquitin-conjugating Enzyme E2 E3, Ubiquitin-protein Ligase E3, Ubiquitin Carrier Protein E3, Ubiquitin-conjugating Enzyme E2-23kD, UbcH9, UBE2E3, UBCE4) (MaxLight 550)
MBS6246263-01 0.1 mL

UBCH9 (Ubiquitin-conjugating Enzyme E2 E3, Ubiquitin-protein Ligase E3, Ubiquitin Carrier Protein E3, Ubiquitin-conjugating Enzyme E2-23kD, UbcH9, UBE2E3, UBCE4) (MaxLight 550)

Sign In for Pricing
View Details
UBCH9 (Ubiquitin-conjugating Enzyme E2 E3, Ubiquitin-protein Ligase E3, Ubiquitin Carrier Protein E3, Ubiquitin-conjugating Enzyme E2-23kD, UbcH9, UBE2E3, UBCE4) (MaxLight 550)
MBS6246263-02 5x 0.1 mL

UBCH9 (Ubiquitin-conjugating Enzyme E2 E3, Ubiquitin-protein Ligase E3, Ubiquitin Carrier Protein E3, Ubiquitin-conjugating Enzyme E2-23kD, UbcH9, UBE2E3, UBCE4) (MaxLight 550)

Sign In for Pricing
View Details
Rabbit Polyclonal Ketohexokinase Antibody
NBP1-85790 0.1 mL

Rabbit Polyclonal Ketohexokinase Antibody

Sign In for Pricing
View Details