Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC189 Peptide - C-terminal region

CCDC189 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C16orf93

UniProt

A1A4V9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC189 Rabbit Polyclonal Antibody (orb326847) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001014979

Preservative

Lyophilized powder

AA Sequence

ETVAPPEPEPSHIHVLRAYIKTQVNKELEQLQGLVEERLKASEERLSSKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAS2R45 Human qPCR Primer Pair (NM_176886)
HP218714 200 Reactions

TAS2R45 Human qPCR Primer Pair (NM_176886)

Sign In for Pricing
View Details
QuantiFluo™ Cholesterol Uptake Assay Kit
DCUT-100 100 Tests

QuantiFluo™ Cholesterol Uptake Assay Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701047 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse CD11c Antibody[N418]
E-AB-F0991R-01 50 Tests

Elab Fluor® Violet 500 Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse CD11c Antibody[N418]
E-AB-F0991R-02 100 Tests

Elab Fluor® Violet 500 Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Anti-Mouse CD11c Antibody[N418]
E-AB-F0991R-03 2x 100 Tests

Elab Fluor® Violet 500 Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details