Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC189 Peptide - C-terminal region

CCDC189 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C16orf93

UniProt

A1A4V9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC189 Rabbit Polyclonal Antibody (orb326847) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001014979

Preservative

Lyophilized powder

AA Sequence

ETVAPPEPEPSHIHVLRAYIKTQVNKELEQLQGLVEERLKASEERLSSKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tgif2lx2 Mouse Gene Knockout Kit (CRISPR)
KN517494 1 Kit

Tgif2lx2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rumenic Acid (~80%)
TRC-R701590-25MG 25 mg

Rumenic Acid (~80%)

Sign In for Pricing
View Details
FAAP24 Rabbit Polyclonal Antibody
TA368282 100 µL

FAAP24 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Spike Trimer Protein (N501Y, D614G), His Tag (MALS verified)
SPN-C52Hp-500ug 500 µg

SARS-CoV-2 Spike Trimer Protein (N501Y, D614G), His Tag (MALS verified)

Sign In for Pricing
View Details
Chsy1 Mouse Gene Knockout Kit (CRISPR)
KN503333 1 Kit

Chsy1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Gelsolin Antibody
RC-5330-01 50 μL

Recombinant Gelsolin Antibody

Sign In for Pricing
View Details