Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC74B Peptide - N-terminal region

CCDC74B Peptide - N-terminal region

Product Specifications

UniProt

Q96LY2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC74B Rabbit Polyclonal Antibody (orb587184) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997193

Preservative

Lyophilized powder

AA Sequence

QHSEMLAKLHEEIEHLKRENKDLRYKLIMNQTSQKKDGPSGNHLSRASAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-L-threoninol
4026268.0001 1 g

Fmoc-L-threoninol

Sign In for Pricing
View Details
Anti-Aldolase C/ALDOC Antibody Picoband®
A05296-1 100 µg/Vial

Anti-Aldolase C/ALDOC Antibody Picoband®

Sign In for Pricing
View Details
Txlna 3'UTR GFP Stable Cell Line
TU272685 1.0 mL

Txlna 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human Kallikrein 3 ELISA Kit
EA100514 96 Well

Human Kallikrein 3 ELISA Kit

Sign In for Pricing
View Details
IGHV2-26 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV764057 1.0 µg DNA

IGHV2-26 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
RANBP10 Antibody, HRP conjugated
A59227-100UG 100 µg

RANBP10 Antibody, HRP conjugated

Sign In for Pricing
View Details