Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC74B Peptide - N-terminal region

CCDC74B Peptide - N-terminal region

Product Specifications

UniProt

Q96LY2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC74B Rabbit Polyclonal Antibody (orb587184) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997193

Preservative

Lyophilized powder

AA Sequence

QHSEMLAKLHEEIEHLKRENKDLRYKLIMNQTSQKKDGPSGNHLSRASAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acer2 (NM_139306) Mouse Tagged ORF Clone
MR216452 10 µg

Acer2 (NM_139306) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Lupinus luteus Protein PR-L3
MBS1133038-01 0.05 mg (E-Coli)

Recombinant Lupinus luteus Protein PR-L3

Sign In for Pricing
View Details
Recombinant Lupinus luteus Protein PR-L3
MBS1133038-02 0.2 mg (E-Coli)

Recombinant Lupinus luteus Protein PR-L3

Sign In for Pricing
View Details
Recombinant Lupinus luteus Protein PR-L3
MBS1133038-03 0.05 mg (Yeast)

Recombinant Lupinus luteus Protein PR-L3

Sign In for Pricing
View Details
Recombinant Lupinus luteus Protein PR-L3
MBS1133038-04 0.5 mg (E-Coli)

Recombinant Lupinus luteus Protein PR-L3

Sign In for Pricing
View Details
Recombinant Lupinus luteus Protein PR-L3
MBS1133038-05 0.05 mg (Baculovirus)

Recombinant Lupinus luteus Protein PR-L3

Sign In for Pricing
View Details