Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mxi1 Peptide - N-terminal region

Mxi1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ENSMUSG00000067085, Gm10197, Mad2, bHLHc11

UniProt

Q3U3X2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Mxi1 Rabbit Polyclonal Antibody (orb576104) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008542

Preservative

Lyophilized powder

AA Sequence

KEARCEGAGLVPVAPPAMPPAAAAPQPPAQPEEPAGAKPRCPFSDIFNTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEBPE Rabbit Polyclonal Antibody
TA313611 100 µL

CEBPE Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAPK4 Polyclonal Antibody
RD219285A-01 20 µL

MAPK4 Polyclonal Antibody

Sign In for Pricing
View Details
MAPK4 Polyclonal Antibody
RD219285A-02 60 μL

MAPK4 Polyclonal Antibody

Sign In for Pricing
View Details
MAPK4 Polyclonal Antibody
RD219285A-03 120 μL

MAPK4 Polyclonal Antibody

Sign In for Pricing
View Details
MAPK4 Polyclonal Antibody
RD219285A-04 200 µL

MAPK4 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal Tryptophan Hydroxylase 1/TPH-1 Antibody (007) [mFluor Violet 450 SE]
NBP2-90021MFV450 0.1 mL

Rabbit Monoclonal Tryptophan Hydroxylase 1/TPH-1 Antibody (007) [mFluor Violet 450 SE]

Sign In for Pricing
View Details