Mxi1 Peptide - N-terminal region
Mxi1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
ENSMUSG00000067085, Gm10197, Mad2, bHLHc11
UniProt
Q3U3X2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Mxi1 Rabbit Polyclonal Antibody (orb576104) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001008542
Preservative
Lyophilized powder
AA Sequence
KEARCEGAGLVPVAPPAMPPAAAAPQPPAQPEEPAGAKPRCPFSDIFNTS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Mouse Monoclonal PI 3-Kinase C2 beta Antibody (OTI3B1) [DyLight 550]](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
NBP2-73395R 0.1 mL
Mouse Monoclonal PI 3-Kinase C2 beta Antibody (OTI3B1) [DyLight 550]
Sign In for Pricing
View Details LV662011 1.0 µg DNA
ATAD3A Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
1031630 500 500 g
Citric Acid Anhydrous AR/ACS Meets Analytical Specification of IP, BP, USP, Ph. Eur.
Sign In for Pricing
View Details