Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arntl Peptide - C-terminal region

Arntl Peptide - C-terminal region

Product Specifications

Product Name Alternative

Arnt3, BMAL1b, Bmal1, MOP3, bHLHe5, bmal1b'

UniProt

Q3UHZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Arntl Rabbit Polyclonal Antibody (orb576109) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031515

Preservative

Lyophilized powder

AA Sequence

GQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Urethane-13C,15N
TRC-U825307-10MG 10 mg

Urethane-13C,15N

Sign In for Pricing
View Details
N-Octanoyl-L-homoserine lactone
TRC-N231755-1G 1 g

N-Octanoyl-L-homoserine lactone

Sign In for Pricing
View Details
Recombinant Human CD45/PTPRC Protein (Fc Tag)
PKSH031885 100 µg

Recombinant Human CD45/PTPRC Protein (Fc Tag)

Sign In for Pricing
View Details
C14orf142 (GON7) Human Gene Knockout Kit (CRISPR)
KN206178 1 Kit

C14orf142 (GON7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Rectum
CS637784 5x 5 µm

Frozen Tissue Sections, Rectum

Sign In for Pricing
View Details
SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF740 conjugate, 0.1mg/mL
BNC740245-500 1x 500 µL

SHBG (Sex Hormone Binding Globulin) (SHBG/245), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details