Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Arntl Peptide - C-terminal region

Arntl Peptide - C-terminal region

Product Specifications

Product Name Alternative

Arnt3, BMAL1b, Bmal1, MOP3, bHLHe5, bmal1b'

UniProt

Q3UHZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Arntl Rabbit Polyclonal Antibody (orb576109) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031515

Preservative

Lyophilized powder

AA Sequence

GQAQETPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAMAVIMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE/Cyanine7 Anti-Mouse CD45 Antibody[30-F11]
E-AB-F1136UH-01 25 µg

PE/Cyanine7 Anti-Mouse CD45 Antibody[30-F11]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD45 Antibody[30-F11]
E-AB-F1136UH-02 100 µg

PE/Cyanine7 Anti-Mouse CD45 Antibody[30-F11]

Sign In for Pricing
View Details
Bcl-2 (100/D5 + 124), CF568 conjugate, 0.1mg/mL
BNC681234-500 1x 500 µL

Bcl-2 (100/D5 + 124), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant 14-3-3 sigma Antibody
RC-15259-01 50 μL

Recombinant 14-3-3 sigma Antibody

Sign In for Pricing
View Details
Recombinant 14-3-3 sigma Antibody
RC-15259-02 100 µL

Recombinant 14-3-3 sigma Antibody

Sign In for Pricing
View Details
Recombinant 14-3-3 sigma Antibody
RC-15259-03 1 mL

Recombinant 14-3-3 sigma Antibody

Sign In for Pricing
View Details