Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lyl1 Peptide - C-terminal region

Lyl1 Peptide - C-terminal region

Product Specifications

UniProt

Q66HH3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lyl1 Rabbit Polyclonal Antibody (orb576145) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007678

Preservative

Lyophilized powder

AA Sequence

GVEGNARCGAGHRVEAARSQPVLPGDCDGDPNGSVRPIKMEQTALSPEVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T-Cell Leukemia Marker) (CD7/3737), CF594 conjugate, 0.1mg/mL
BNC942056-500 1x 500 µL

CD7 (T-Cell Leukemia Marker) (CD7/3737), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BOLA2 (NM_001031827) Human Over-expression Lysate
LY422200 100 µg

BOLA2 (NM_001031827) Human Over-expression Lysate

Sign In for Pricing
View Details
Resistant Starch Microplate Assay Kit
RDSM123 100 Assays

Resistant Starch Microplate Assay Kit

Sign In for Pricing
View Details
Faim (NM_011810) Mouse Tagged ORF Clone
MG201595 10 µg

Faim (NM_011810) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
CA12 Antibody (Biotin)
KB-22760-01 50 μL

CA12 Antibody (Biotin)

Sign In for Pricing
View Details
CA12 Antibody (Biotin)
KB-22760-02 100 µL

CA12 Antibody (Biotin)

Sign In for Pricing
View Details