Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lyl1 Peptide - C-terminal region

Lyl1 Peptide - C-terminal region

Product Specifications

UniProt

Q66HH3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lyl1 Rabbit Polyclonal Antibody (orb576145) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007678

Preservative

Lyophilized powder

AA Sequence

GVEGNARCGAGHRVEAARSQPVLPGDCDGDPNGSVRPIKMEQTALSPEVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Metribuzin
TRC-M338920-250MG 250 mg

Metribuzin

Sign In for Pricing
View Details
HPV16 E2 (Human Papilloma Virus 16) (TVG 261), CF647 conjugate, 0.1mg/mL
BNC473073-500 1x 500 µL

HPV16 E2 (Human Papilloma Virus 16) (TVG 261), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BDH1 Polyclonal Antibody
E-AB-14789-01 20 µL

BDH1 Polyclonal Antibody

Sign In for Pricing
View Details
BDH1 Polyclonal Antibody
E-AB-14789-02 60 µL

BDH1 Polyclonal Antibody

Sign In for Pricing
View Details
BDH1 Polyclonal Antibody
E-AB-14789-03 120 µL

BDH1 Polyclonal Antibody

Sign In for Pricing
View Details
BDH1 Polyclonal Antibody
E-AB-14789-04 200 µL

BDH1 Polyclonal Antibody

Sign In for Pricing
View Details