Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcea2 Peptide - middle region

Tcea2 Peptide - middle region

Product Specifications

UniProt

Q63799

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tcea2 Rabbit Polyclonal Antibody (orb324673) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_476439

Preservative

Lyophilized powder

AA Sequence

SVNALRKQSSDEELIALAKSLIKSWKKLLDVSDGKSRDQGRGTPLPTSSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TM4SF1 Recombinant Protein (Mouse)
RP179006 100 µg

TM4SF1 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Recombinant Bordetella avium Macrolide export ATP-binding/permease protein MacB (macB)
orb2913432-01 20 µg

Recombinant Bordetella avium Macrolide export ATP-binding/permease protein MacB (macB)

Sign In for Pricing
View Details
Recombinant Bordetella avium Macrolide export ATP-binding/permease protein MacB (macB)
orb2913432-02 100 µg

Recombinant Bordetella avium Macrolide export ATP-binding/permease protein MacB (macB)

Sign In for Pricing
View Details
Allo-inositol
C8149-25 25 mg

Allo-inositol

Sign In for Pricing
View Details
alpha Lactalbumin Mouse mAb
MBS8808548-01 0.05 mL

alpha Lactalbumin Mouse mAb

Sign In for Pricing
View Details
alpha Lactalbumin Mouse mAb
MBS8808548-02 0.1 mL

alpha Lactalbumin Mouse mAb

Sign In for Pricing
View Details