Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxa1 Peptide - C-terminal region

Hoxa1 Peptide - C-terminal region

Product Specifications

UniProt

O08656

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxa1 Rabbit Polyclonal Antibody (orb329905) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037207

Preservative

Lyophilized powder

AA Sequence

KYLTRARSEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPMSPATPPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BPV-1 E2 tag (SSTSSDFRDR) Mouse Monoclonal Antibody [Clone ID: 5E11]
AM26099PU-N 100 µg

BPV-1 E2 tag (SSTSSDFRDR) Mouse Monoclonal Antibody [Clone ID: 5E11]

Sign In for Pricing
View Details
PE/Cyanine5.5 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09812I-01 20 Tests

PE/Cyanine5.5 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
PE/Cyanine5.5 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09812I-02 100 Tests

PE/Cyanine5.5 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
PE/Cyanine5.5 Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09812I-03 2x 100 Tests

PE/Cyanine5.5 Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
Lanoconazole
TRC-L174500-250MG 250 mg

Lanoconazole

Sign In for Pricing
View Details
PKC-gamma Antibody
KC-17366-01 50 μL

PKC-gamma Antibody

Sign In for Pricing
View Details