Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxa1 Peptide - C-terminal region

Hoxa1 Peptide - C-terminal region

Product Specifications

UniProt

O08656

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hoxa1 Rabbit Polyclonal Antibody (orb329905) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037207

Preservative

Lyophilized powder

AA Sequence

KYLTRARSEIAASLQLNETQVKIWFQNRRMKQKKREKEGLLPMSPATPPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NucSpot® 568/580, 1000X in DMSO
#41036 1x 100 µL

NucSpot® 568/580, 1000X in DMSO

Sign In for Pricing
View Details
Lauroyl-L-carnitine-d3 Hydrochloride
TRC-L178682-25MG 25 mg

Lauroyl-L-carnitine-d3 Hydrochloride

Sign In for Pricing
View Details
KIST (UHMK1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D3]
TA501719BM 100 µL

KIST (UHMK1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D3]

Sign In for Pricing
View Details
Met (Ab-1349) Antibody
8B7152-AAT 50 µg

Met (Ab-1349) Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Brain
CS801376 5x 5 µm

Tissue FFPE Sections, Brain

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB523219 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details