Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sfpi1 Peptide - N-terminal region

Sfpi1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Dis-1, Dis1, PU.1, Sfpi-1, Spi-1, Spi1, Tcfpu1, Tfpu.1, Sfpi1

UniProt

P17433

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sfpi1 Rabbit Polyclonal Antibody (orb324681) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_035485

Preservative

Lyophilized powder

AA Sequence

MLQACKMEGFSLTAPPSDDLVTYDSELYQRPMHDYYSFVGSDGESHSDHY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

20% SDS Solution
EC-874-01 100 mL

20% SDS Solution

Sign In for Pricing
View Details
20% SDS Solution
EC-874-02 450 mL

20% SDS Solution

Sign In for Pricing
View Details
Mouse Dnase1 activation kit by CRISPRa
GA201099 1 Kit

Mouse Dnase1 activation kit by CRISPRa

Sign In for Pricing
View Details
SCGB3A2 Antibody
KC-1703-01 50 μL

SCGB3A2 Antibody

Sign In for Pricing
View Details
SCGB3A2 Antibody
KC-1703-02 100 µL

SCGB3A2 Antibody

Sign In for Pricing
View Details
SCGB3A2 Antibody
KC-1703-03 1 mL

SCGB3A2 Antibody

Sign In for Pricing
View Details