Sfpi1 Peptide - N-terminal region
Sfpi1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Dis-1, Dis1, PU.1, Sfpi-1, Spi-1, Spi1, Tcfpu1, Tfpu.1, Sfpi1
UniProt
P17433
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Sfpi1 Rabbit Polyclonal Antibody (orb324681) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_035485
Preservative
Lyophilized powder
AA Sequence
MLQACKMEGFSLTAPPSDDLVTYDSELYQRPMHDYYSFVGSDGESHSDHY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940879-500 1x 500 µL
P57 / KIP2 (KP10), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042940-500 1x 500 µL
CD79b (B-Cell Marker) (IGB/2940R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
