Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ptf1a Peptide - N-terminal region

Ptf1a Peptide - N-terminal region

Product Specifications

Product Name Alternative

PTF1-p48, PTF1p48, bHLHa29

UniProt

Q9QX98

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ptf1a Rabbit Polyclonal Antibody (orb329915) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_061279

Preservative

Lyophilized powder

AA Sequence

FPSPYFDEEDFFTDQSSRDPLEDSDELLGDEQAEVEFLSHQLHEYCYRDG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat tRNA splicing endonuclease subunit Sen2 (TSEN2) ELISA Kit
GTR10315798 96 Well

Rat tRNA splicing endonuclease subunit Sen2 (TSEN2) ELISA Kit

Sign In for Pricing
View Details
Human Thrombin Matched Antibody Pair Set [ABP-S-02772]
ABP-S-02772 5 Plates

Human Thrombin Matched Antibody Pair Set [ABP-S-02772]

Sign In for Pricing
View Details
Bcl6 Antibody
orb1730167 100 µL

Bcl6 Antibody

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans B0495.8 Polyclonal Antibody
MBS7144052 Inquire

Rabbit anti-Caenorhabditis elegans B0495.8 Polyclonal Antibody

Sign In for Pricing
View Details
Interleukin 8 (IL-8) (HRP)
I8430-15-HRP 100 µL

Interleukin 8 (IL-8) (HRP)

Sign In for Pricing
View Details
Rat Ramac Pre-designed siRNA Set A
SI211592A 1 Each

Rat Ramac Pre-designed siRNA Set A

Sign In for Pricing
View Details