Atf7ip Peptide - middle region
Atf7ip Peptide - middle region
Product Specifications
Product Name Alternative
2610204M12Rik, AM, Mcaf1
UniProt
Q7TT18
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Atf7ip Rabbit Polyclonal Antibody (orb324683) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_062299
Preservative
Lyophilized powder
AA Sequence
MSTPEGEKSEKDGKAEEEERVPAEEQPPVRNEFSRRKRSKSEDMDSVESK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682425-500 1x 500 µL
BOB.1 (B-Cell Marker) (BOB1/2425), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TP305639M 100 µg
Apc6 (CDC16) (NM_003903) Human Recombinant Protein
Sign In for Pricing
View Details 
![LAMP2a Recombinant Rabbit Monoclonal Antibody [SA46-01]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea80d44/imageurl/et1601-24.webp)
ET1601-24 100 µL
LAMP2a Recombinant Rabbit Monoclonal Antibody [SA46-01]
Sign In for Pricing
View Details 
BNC470296-100 1x 100 µL
Blood Group Antigen B (CD173) (HEB-20), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details