Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vsx1 Peptide - C-terminal region

Vsx1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CHX10-like

UniProt

Q91V10

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vsx1 Rabbit Polyclonal Antibody (orb576307) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_473409

Preservative

Lyophilized powder

AA Sequence

TGMRKPESEDKLAGLWEFDHLKKGANKDEDGPERGPDETTQNPENSLEDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Substance P polyclonal antibody
orb1725171-01 50 µL

Substance P polyclonal antibody

Sign In for Pricing
View Details
Substance P polyclonal antibody
orb1725171-02 100 µL

Substance P polyclonal antibody

Sign In for Pricing
View Details
Pnma1 (NM_130820) Rat Tagged ORF Clone Lentiviral Particle
RR210790L3V 200 µL

Pnma1 (NM_130820) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Tetramethylammonium hydrogen sulfate monohydrate
sc-229436 50 g

Tetramethylammonium hydrogen sulfate monohydrate

Sign In for Pricing
View Details
(3R,7Z,10Z,13Z,16Z) -3-Hydroxydocosatetraenoyl-CoA
orb3021540-01 50 mg

(3R,7Z,10Z,13Z,16Z) -3-Hydroxydocosatetraenoyl-CoA

Sign In for Pricing
View Details
(3R,7Z,10Z,13Z,16Z) -3-Hydroxydocosatetraenoyl-CoA
orb3021540-02 10 mg

(3R,7Z,10Z,13Z,16Z) -3-Hydroxydocosatetraenoyl-CoA

Sign In for Pricing
View Details