Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vsx1 Peptide - C-terminal region

Vsx1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CHX10-like

UniProt

Q91V10

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vsx1 Rabbit Polyclonal Antibody (orb576307) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_473409

Preservative

Lyophilized powder

AA Sequence

TGMRKPESEDKLAGLWEFDHLKKGANKDEDGPERGPDETTQNPENSLEDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCG2 (ATP-binding Cassette Sub-family G Member 2, Placenta-specific ATP-binding Cassette Transporter, Breast Cancer Resistance Protein, Mitoxantrone Resistance-associated Protein, CD338 Antigen, CDw338, ABCP, BCRP, BCRP1, MXR) (AP) discontinued
122819-AP 100 µL

ABCG2 (ATP-binding Cassette Sub-family G Member 2, Placenta-specific ATP-binding Cassette Transporter, Breast Cancer Resistance Protein, Mitoxantrone Resistance-associated Protein, CD338 Antigen, CDw338, ABCP, BCRP, BCRP1, MXR) (AP) discontinued

Sign In for Pricing
View Details
Multiplex Assay Kit for Titin (TTN)
TRV-0028330 96 Tests

Multiplex Assay Kit for Titin (TTN)

Sign In for Pricing
View Details
DDX17 (H-7) Alexa Fluor® 647
sc-398168 AF647 200 µg/mL

DDX17 (H-7) Alexa Fluor® 647

Sign In for Pricing
View Details
DDX56 Protein Vector (Mouse) (pPB-N-His)
PV171283 500 ng

DDX56 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Doublin Monoclonal Antibody, AbBy Fluor™ 350 Conjugated
bsm-63046R-BF350 100 µL

Doublin Monoclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
STAM Rabbit Polyclonal Antibody (Cy7)
orb1038951 100 µL

STAM Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details