Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vsx1 Peptide - C-terminal region

Vsx1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CHX10-like

UniProt

Q91V10

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vsx1 Rabbit Polyclonal Antibody (orb576307) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_473409

Preservative

Lyophilized powder

AA Sequence

TGMRKPESEDKLAGLWEFDHLKKGANKDEDGPERGPDETTQNPENSLEDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mycoplasma capricolum subsp. Capripneumoniae One-Step PCR kit
Oneq-M413-100D 100T

Mycoplasma capricolum subsp. Capripneumoniae One-Step PCR kit

Sign In for Pricing
View Details
Mouse Anti-Human CD8-PE/TXRD
9536-10 100 Tests

Mouse Anti-Human CD8-PE/TXRD

Sign In for Pricing
View Details
Tmem92-ps sgRNA CRISPR Lentivector set (Mouse)
K3278001 3x 1.0 µg

Tmem92-ps sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Anti-CRABP2 Antibody (R1T68)
RHD83201 100 μg

Anti-CRABP2 Antibody (R1T68)

Sign In for Pricing
View Details
Sheep Contactin 1 ELISA Kit
MBS742675-01 48 Well

Sheep Contactin 1 ELISA Kit

Sign In for Pricing
View Details
Sheep Contactin 1 ELISA Kit
MBS742675-02 96 Well

Sheep Contactin 1 ELISA Kit

Sign In for Pricing
View Details