Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vsx1 Peptide - C-terminal region

Vsx1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CHX10-like

UniProt

Q91V10

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Vsx1 Rabbit Polyclonal Antibody (orb576307) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_473409

Preservative

Lyophilized powder

AA Sequence

TGMRKPESEDKLAGLWEFDHLKKGANKDEDGPERGPDETTQNPENSLEDV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3EAP (DNA-directed RNA Polymerase I Subunit RPA34, A34.5, Antisense to ERCC-1 Protein, ASE-1, CD3-epsilon-associated Protein, CAST, CD3E-associated Protein, RNA Polymerase I-associated Factor PAF49, ASE1, CAST, PAF49) (APC)
124624-APC 100 µL

CD3EAP (DNA-directed RNA Polymerase I Subunit RPA34, A34.5, Antisense to ERCC-1 Protein, ASE-1, CD3-epsilon-associated Protein, CAST, CD3E-associated Protein, RNA Polymerase I-associated Factor PAF49, ASE1, CAST, PAF49) (APC)

Sign In for Pricing
View Details
TIGD1 Antibody
CSB-PA008033-01 50 µg

TIGD1 Antibody

Sign In for Pricing
View Details
TIGD1 Antibody
CSB-PA008033-02 100 µg

TIGD1 Antibody

Sign In for Pricing
View Details
ZNF17 Rabbit Polyclonal Antibody (FITC)
orb2132044 100 µL

ZNF17 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
ELISA kit for Human Cullin-9 (CUL9)
KTE62415-01 48 Tests

ELISA kit for Human Cullin-9 (CUL9)

Sign In for Pricing
View Details
ELISA kit for Human Cullin-9 (CUL9)
KTE62415-02 96 Tests

ELISA kit for Human Cullin-9 (CUL9)

Sign In for Pricing
View Details