Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sp7 Peptide - N-terminal region

Sp7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Osx

UniProt

Q6IMK1

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sp7 Rabbit Polyclonal Antibody (orb333707) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032721

Preservative

Lyophilized powder

AA Sequence

MLTAACSKFGGSSPLRDSTALGKGGTKKPYTDLSAPKTMGDAYPAPFSST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sfn Mouse Gene Knockout Kit (CRISPR)
KN515651 1 Kit

Sfn Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anti-MERS-CoV (NCoV/Novel coronavirus) Spike Monoclonal Antibody
E-AB-V1302-01 200 µL

Anti-MERS-CoV (NCoV/Novel coronavirus) Spike Monoclonal Antibody

Sign In for Pricing
View Details
Anti-MERS-CoV (NCoV/Novel coronavirus) Spike Monoclonal Antibody
E-AB-V1302-02 500 µL

Anti-MERS-CoV (NCoV/Novel coronavirus) Spike Monoclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS622092 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Wortmannin
TRC-W499400-5MG 5 mg

Wortmannin

Sign In for Pricing
View Details