Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sp7 Peptide - N-terminal region

Sp7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Osx

UniProt

Q6IMK1

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Sp7 Rabbit Polyclonal Antibody (orb333707) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032721

Preservative

Lyophilized powder

AA Sequence

MLTAACSKFGGSSPLRDSTALGKGGTKKPYTDLSAPKTMGDAYPAPFSST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Borane Ammonia Complex
TRC-B675275-1G 1 g

Borane Ammonia Complex

Sign In for Pricing
View Details
Sulfamoxole
TRC-S689010-1G 1 g

Sulfamoxole

Sign In for Pricing
View Details
ZG16B Human Gene Knockout Kit (CRISPR)
KN202244RB 1 Kit

ZG16B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant DPEP3 Antibody
RC-6612-01 50 μL

Recombinant DPEP3 Antibody

Sign In for Pricing
View Details
Recombinant DPEP3 Antibody
RC-6612-02 100 µL

Recombinant DPEP3 Antibody

Sign In for Pricing
View Details
Recombinant DPEP3 Antibody
RC-6612-03 1 mL

Recombinant DPEP3 Antibody

Sign In for Pricing
View Details