Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp445 Peptide - middle region

Zfp445 Peptide - middle region

Product Specifications

Product Name Alternative

AW610627, ZNF168, Znf445, mszf29, mszf50

UniProt

Q8R2V3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp445 Rabbit Polyclonal Antibody (orb324717) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775540

Preservative

Lyophilized powder

AA Sequence

NFRKSSHHYNNKYGEGLRGTGEGFGVYQNTGLKENGKDRYGETSRKSWHA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-Tubulin Antibody
KC-3070-01 50 μL

Beta-Tubulin Antibody

Sign In for Pricing
View Details
Beta-Tubulin Antibody
KC-3070-02 100 µL

Beta-Tubulin Antibody

Sign In for Pricing
View Details
Beta-Tubulin Antibody
KC-3070-03 1 mL

Beta-Tubulin Antibody

Sign In for Pricing
View Details
Complement C4d (C4D205), Biotin conjugate, 0.1mg/mL
BNCB0205-500 1x 500 µL

Complement C4d (C4D205), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-(4-Chlorophenyl)glutaric Acid
TRC-C378250-250MG 250 mg

3-(4-Chlorophenyl)glutaric Acid

Sign In for Pricing
View Details
3,5-Dinitro-o-toluic Acid
TRC-D480873-5G 5 g

3,5-Dinitro-o-toluic Acid

Sign In for Pricing
View Details