Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rbfox2 Peptide - N-terminal region

Rbfox2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2810460A15Rik, AA407676, AI118529, Fbm2, Fxh, Hrnbp2, Rbm9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Rbfox2 Rabbit Polyclonal Antibody (orb324719) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001104297

Preservative

Lyophilized powder

AA Sequence

PVPGAGADGPEPGLSKRPRTEEAADGGMQNEPLTPGYHGFPARDGQGNQE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Chloroaniline-2,6-d2
TRC-C377501-25MG 25 mg

4-Chloroaniline-2,6-d2

Sign In for Pricing
View Details
Purified Anti-Human CD135 Antibody[BV10 (BV10A4) ]
AN004070P-01 25 µg

Purified Anti-Human CD135 Antibody[BV10 (BV10A4) ]

Sign In for Pricing
View Details
Purified Anti-Human CD135 Antibody[BV10 (BV10A4) ]
AN004070P-02 100 µg

Purified Anti-Human CD135 Antibody[BV10 (BV10A4) ]

Sign In for Pricing
View Details
Itgam Rat Monoclonal Antibody [Clone ID: M1/70]
TA363844 250 µg

Itgam Rat Monoclonal Antibody [Clone ID: M1/70]

Sign In for Pricing
View Details
Formononetin
TRC-F693200-5G 5 g

Formononetin

Sign In for Pricing
View Details
Trub2 Mouse Gene Knockout Kit (CRISPR)
KN518315 1 Kit

Trub2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details